FLT3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A12437
Article Name: FLT3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12437
Supplier Catalog Number: A12437
Alternative Catalog Number: ABB-A12437-100UL,ABB-A12437-20UL,ABB-A12437-500UL,ABB-A12437-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: FLK2, STK1, CD135, FLK-2, FLT3
This gene encodes a class III receptor tyrosine kinase that regulates hematopoiesis. This receptor is activated by binding of the fms-related tyrosine kinase 3 ligand to the extracellular domain, which induces homodimer formation in the plasma membrane leading to autophosphorylation of the receptor. The activated receptor kinase subsequently phosphorylates and activates multiple cytoplasmic effector molecules in pathways involved in apoptosis, proliferation, and differentiation of hematopoietic cells in bone marrow. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.
Clonality: Polyclonal
Molecular Weight: 113kDa
NCBI: 2322
UniProt: P36888
Purity: Affinity purification
Sequence: NYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGME
Target: FLT3
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Protein phosphorylation,Signal Transduction,Kinase,Tyrosine kinases,Immunology Inflammation,CDs,Stem Cells.