[KO Validated] CD168/RHAMM Rabbit pAb, Unconjugated

Catalog Number: ABB-A12445
Article Name: [KO Validated] CD168/RHAMM Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A12445
Supplier Catalog Number: A12445
Alternative Catalog Number: ABB-A12445-100UL,ABB-A12445-20UL,ABB-A12445-500UL,ABB-A12445-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CD168, IHABP, RHAMM, MM
The protein encoded by this gene is involved in cell motility. It is expressed in breast tissue and together with other proteins, it forms a complex with BRCA1 and BRCA2, thus is potentially associated with higher risk of breast cancer. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 3161
UniProt: O75330
Purity: Affinity purification
Sequence: MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDTTLPASARKVKSSESKKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLNAALREKTSLSANNATLEKQLIELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETKMRGMMAKQEGMEMKLQVTQRSLEESQGKIAQLEGKLVSIEKEKIDEKSETEKLLEYIEEISCASDQVEKYKLDI
Target: HMMR
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human, ResearchArea: Cancer,Tumor immunology,Cell Biology Developmental Biology,Immunology Inflammation,CDs,Stem Cells,Embryonic Stem Cells.