ZP3 Rabbit pAb, Unconjugated

Catalog Number: ABB-A13156
Article Name: ZP3 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A13156
Supplier Catalog Number: A13156
Alternative Catalog Number: ABB-A13156-20UL,ABB-A13156-100UL,ABB-A13156-1000UL,ABB-A13156-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ZPC, ZP3A, ZP3B, Zp-3, OOMD3, OZEMA3, ZP3
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus, however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene.
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 7784
UniProt: P21754
Purity: Affinity purification
Sequence: DASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCCNKGDCGTPSHSRRQPHVMSQWSR
Target: ZP3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat