RBM14 Rabbit pAb, Unconjugated

Catalog Number: ABB-A13159
Article Name: RBM14 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A13159
Supplier Catalog Number: A13159
Alternative Catalog Number: ABB-A13159-20UL,ABB-A13159-100UL,ABB-A13159-1000UL,ABB-A13159-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SIP, COAA, PSP2, SYTIP1, TMEM137, RBM14
This gene encodes a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation. Alternatively spliced transcript variants encoding different isoforms (with opposing effects on transcription) have been described for this gene.
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 10432
UniProt: Q96PK6
Purity: Affinity purification
Sequence: VVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRS
Target: RBM14
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding.