IL-1 alpha Rabbit pAb, Unconjugated

Catalog Number: ABB-A1316
Article Name: IL-1 alpha Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1316
Supplier Catalog Number: A1316
Alternative Catalog Number: ABB-A1316-20UL,ABB-A1316-100UL,ABB-A1316-500UL,ABB-A1316-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimers disease.
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 3552
UniProt: P01583
Purity: Affinity purification
Sequence: SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQIL
Target: IL1A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Growth factors,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,Cytokines,Interleukins,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases.