U2AF1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A13166
Article Name: U2AF1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A13166
Supplier Catalog Number: A13166
Alternative Catalog Number: ABB-A13166-20UL,ABB-A13166-100UL,ABB-A13166-500UL,ABB-A13166-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RN, FP793, U2AF35, U2AFBP, RNU2AF1, U2AF1
This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified.
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 7307
UniProt: Q01081
Purity: Affinity purification
Sequence: MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
Target: U2AF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology,Apoptosis.