PER2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PER2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13168
• Supplier Catalog Number: A13168
• Alternative Catalog Number: ABB-A13168-20UL,ABB-A13168-100UL,ABB-A13168-1000UL,ABB-A13168-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: FASPS, FASPS1, PER2

Product Description

This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 137kDa
• NCBI: 8864
• UniProt: O15055
• Purity: Affinity purification
• Sequence: GQPFDYSPIRFRARNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSIQELTEQIHRLLLQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEICKNGNKTKNRSHYSHESGEQKKKSVTEMQTNPPAEKKAVPAMEKDSLGV
• Target: PER2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 10µg-15µg of Chromatin
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Cardiovascular,Blood.

Images