Cathepsin G Rabbit pAb, Unconjugated

Product Overview

• Article Name: Cathepsin G Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13172
• Supplier Catalog Number: A13172
• Alternative Catalog Number: ABB-A13172-20UL,ABB-A13172-100UL,ABB-A13172-500UL,ABB-A13172-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CG, CATG, Cathepsin G

Product Description

The protein encoded by this gene, a member of the peptidase S1 protein family, is found in azurophil granules of neutrophilic polymorphonuclear leukocytes. The encoded protease has a specificity similar to that of chymotrypsin C, and may participate in the killing and digestion of engulfed pathogens, and in connective tissue remodeling at sites of inflammation. In addition, the encoded protein is antimicrobial, with bacteriocidal activity against S. aureus and N. gonorrhoeae. Transcript variants utilizing alternative polyadenylation signals exist for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 29kDa
• NCBI: 1511
• UniProt: P08311
• Purity: Affinity purification
• Sequence: GAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDR
• Target: CTSG
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Extracellular Matrix,Neuroscience.

Images