TDO2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A13182
Article Name: TDO2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A13182
Supplier Catalog Number: A13182
Alternative Catalog Number: ABB-A13182-20UL,ABB-A13182-100UL,ABB-A13182-500UL,ABB-A13182-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TO, TDO, TPH2, TRPO, HYPTRP, TDO2
This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 6999
UniProt: P48775
Purity: Affinity purification
Sequence: GHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYR
Target: TDO2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism.