ZC3H7A Rabbit pAb, Unconjugated

Product Overview

• Article Name: ZC3H7A Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13190
• Supplier Catalog Number: A13190
• Alternative Catalog Number: ABB-A13190-20UL,ABB-A13190-100UL,ABB-A13190-1000UL,ABB-A13190-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ZC3H7, HSPC055, ZC3HDC7, ZC3H7A

Product Description

Enables miRNA binding activity. Involved in production of miRNAs involved in gene silencing by miRNA. Predicted to be located in nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 111kDa
• NCBI: 29066
• UniProt: Q8IWR0
• Purity: Affinity purification
• Sequence: MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVRAELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVS
• Target: ZC3H7A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cell Biology Developmental Biology.

Images