PIWIL4 Rabbit pAb, Unconjugated

Product Overview

• Article Name: PIWIL4 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13201
• Supplier Catalog Number: A13201
• Alternative Catalog Number: ABB-A13201-100UL,ABB-A13201-20UL,ABB-A13201-500UL,ABB-A13201-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HIWI2, MIWI2, PIWIL4

Product Description

PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 97kDa
• NCBI: 143689
• UniProt: Q7Z3Z4
• Purity: Affinity purification
• Sequence: SADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHI
• Target: PIWIL4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling.

Images