CTCF Rabbit pAb, Unconjugated

Catalog Number: ABB-A13272
Article Name: CTCF Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A13272
Supplier Catalog Number: A13272
Alternative Catalog Number: ABB-A13272-20UL,ABB-A13272-100UL,ABB-A13272-500UL,ABB-A13272-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ChIP, ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MRD21, FAP108, CFAP108, CTCF
This gene is a member of the BORIS + CTCF gene family and encodes a transcriptional regulator protein with 11 highly conserved zinc finger (ZF) domains. This nuclear protein is able to use different combinations of the ZF domains to bind different DNA target sequences and proteins. Depending upon the context of the site, the protein can bind a histone acetyltransferase (HAT)-containing complex and function as a transcriptional activator or bind a histone deacetylase (HDAC)-containing complex and function as a transcriptional repressor. If the protein is bound to a transcriptional insulator element, it can block communication between enhancers and upstream promoters, thereby regulating imprinted expression. Mutations in this gene have been associated with invasive breast cancers, prostate cancers, and Wilms tumors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 83 kDa
NCBI: 10664
UniProt: P49711
Purity: Affinity purification
Sequence: MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEVNAEKVVGNMKPPKPT
Target: CTCF
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.
Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CTCF Rabbit pAb (A13272) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human normal cervix using CTCF Rabbit pAb (A13272) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from Jurkat cells using CTCF Rabbit pAb (A13272) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30 s.
Immunohistochemistry analysis of paraffin-embedded Mouse colon using CTCF Rabbit pAb (A13272) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen using CTCF Rabbit pAb (A13272) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Confocal immunofluorescence analysis of Hela cells using CTCF Rabbit pAb (A13272) at dilution of 1:100. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of U-2 OS cells using CTCF Rabbit pAb (A13272) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation of CTCF from 200 µg extracts of Jurkat cells was performed using 3 µg of CTCF Rabbit pAb (A13272). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1* Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTCF Rabbit pAb (A13272) at a dilution of 1:1000.
Chromatin immunoprecipitation analysis of extracts of 293T cells, using CTCF Rabbit pAb (A13272) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.