[KO Validated] SOD2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A1340
Article Name: [KO Validated] SOD2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A1340
Supplier Catalog Number: A1340
Alternative Catalog Number: ABB-A1340-100UL,ABB-A1340-20UL,ABB-A1340-1000UL,ABB-A1340-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GC1, IPOB, IPO-B, MNSOD, MVCD6, GClnc1, Mn-SOD, D2
This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.
Clonality: Polyclonal
Molecular Weight: 25 kDa
NCBI: 6648
UniProt: P04179
Purity: Affinity purification
Sequence: KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Target: SOD2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases,Cardiovascular,Hypoxia.