CHMP2B Rabbit pAb, Unconjugated

Product Overview

• Article Name: CHMP2B Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A13410
• Supplier Catalog Number: A13410
• Alternative Catalog Number: ABB-A13410-20UL,ABB-A13410-100UL,ABB-A13410-500UL,ABB-A13410-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DMT1, ALS17, VPS2B, VPS2-2, CHMP2.5, FTDALS7, CHMP2B

Product Description

This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 25978
• UniProt: Q9UQN3
• Purity: Affinity purification
• Sequence: MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
• Target: CHMP2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Autophagy,Neuroscience,Neurodegenerative Diseases.

Images