SARS-CoV-2 Spike Rabbit pAb

Catalog Number: ABB-A20137
Article Name: SARS-CoV-2 Spike Rabbit pAb
Biozol Catalog Number: ABB-A20137
Supplier Catalog Number: A20137
Alternative Catalog Number: ABB-A20137-100UL,ABB-A20137-20UL,ABB-A20137-500UL,ABB-A20137-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: DOT, ELISA, IF, IP, WB
Species Reactivity: Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Clonality: Polyclonal
Molecular Weight: 141kDa
NCBI: 43740568
UniProt: P0DTC2
Purity: Affinity purification
Sequence: PGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLG
Target: Spike
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|DB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: SARS-CoV-2
Western blot analysis of extracts of 293T and transfected 293T-S ECD(His-tag), using SARS-CoV-2 Spike Rabbit pAb (A20137) at 1:1000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immobilized Recombinant SARS-COV-2 S1+S2 ECD(S-ECD) Protein (RP01283) at 1µg/mL (100µL/well) can bind SARS-CoV-2 Spike Rabbit pAb (A20137) with a linear range of 0.78-50ng/mL.
Western blot analysis of extracts of 293T and transfected 293T-S1(His-tag), using SARS-CoV-2 Spike Rabbit pAb (A20137) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunofluorescence analysis of 293T cells transfected with SARS-CoV-2 Spike protein and untreated 293T cells use SARS-CoV-2 Spike Rabbit pAb (A20137) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 µg extracts of 293T cells using 3 µg SARS-CoV-2 Spike antibody (A20137). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike antibody (A20137) at a dilution of 1:1000.