SARS-CoV-2 Spike S2 ECD Rabbit pAb

Catalog Number: ABB-A20138
Article Name: SARS-CoV-2 Spike S2 ECD Rabbit pAb
Biozol Catalog Number: ABB-A20138
Supplier Catalog Number: A20138
Alternative Catalog Number: ABB-A20138-20UL,ABB-A20138-100UL,ABB-A20138-1000UL,ABB-A20138-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: DOT, ELISA, IF, IP, WB
Species Reactivity: Human, Virus
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Alternative Names: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike S2 ECD
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Clonality: Polyclonal
Molecular Weight: 141kDa
NCBI: 43740568
UniProt: P0DTC2
Purity: Affinity purification
Sequence: SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSS
Target: Spike S2 ECD
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:6000|DB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,SARS-CoV-2