SARS-CoV-2 ORF3A Rabbit pAb

Product Overview

• Article Name: SARS-CoV-2 ORF3A Rabbit pAb
• Biozol Catalog Number: ABB-A20234
• Supplier Catalog Number: A20234
• Alternative Catalog Number: ABB-A20234-100UL,ABB-A20234-20UL,ABB-A20234-1000UL,ABB-A20234-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Virus
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Alternative Names: sars-cov-2

Product Description

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF3a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF3a protein is thought to be a protein with ion channel activity (viroporin) that activates the NLRP3 inflammasome. ORF3a may also play a role in virus replication and pathogenesis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 31kDa
• NCBI: 43740569
• UniProt: P0DTC3
• Purity: Affinity purification
• Sequence: GLEAPFLYLYALVYFLQSINFVRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPISEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEPEEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
• Target: ORF3A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:2000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: SARS-CoV-2

Images

Western blot analysis of lysates from 293T cells, using SARS-CoV-2 ORF3A Rabbit pAb (A20234) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.