SARS-CoV-2 ORF9b Rabbit pAb

Product Overview

• Article Name: SARS-CoV-2 ORF9b Rabbit pAb
• Biozol Catalog Number: ABB-A20260
• Supplier Catalog Number: A20260
• Alternative Catalog Number: ABB-A20260-100UL,ABB-A20260-20UL,ABB-A20260-500UL,ABB-A20260-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Virus
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Alternative Names: sars-cov-2

Product Description

SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) is the causative agent of the COVID19 pandemic.?? SARS-CoV-2 and SARS-CoVshare many proteins common in other CoVs, including 4 majorstructural proteins (S, E, M, and N proteins) and 16 nonstructuralproteins (nsp1-16), they possess a unique set of proteins, namelyorf3a, 3b, 6, 7a, 7b, 8a, 8b, and 9bThe SARS-CoV-2 genome encodes for a small accessory protein termed Orf9b,?? which targets the mitochondrial outer membrane protein TOM70 in infected cells.This 98-amino acid (aa) protein is encoded by analternative open reading frame (ORF) within the N gene and istranslated via a leaky scanning mechanism during translationCrystal structures of orf9b alone revealed a homodimericbeta-strand-rich structure? with a hydro_x005fphobic central tunnel for lipid binding, consistent with the role oforf9b in the mature virion assembly

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 11kDa
• UniProt: P0DTD2
• Purity: Affinity purification
• Sequence: MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
• Target: ORF9b
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: SARS-CoV-2

Images

Western blot analysis of extracts of normal 293T cells 293T transfected with ORF9b Protein, using SARS-CoV-2 ORF9b Rabbit pAb (A20260) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.