SARS-CoV-2 NSP4 Rabbit pAb

Catalog Number: ABB-A20281
Article Name: SARS-CoV-2 NSP4 Rabbit pAb
Biozol Catalog Number: ABB-A20281
Supplier Catalog Number: A20281
Alternative Catalog Number: ABB-A20281-20UL,ABB-A20281-100UL,ABB-A20281-1000UL,ABB-A20281-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IP, WB
Species Reactivity: Virus
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF1ab, the largest gene, contains overlapping open reading frames that encode polyproteins PP1ab and PP1a. The polyproteins are cleaved to yield 16 nonstructural proteins, NSP1-16. Production of the longer (PP1ab) or shorter protein (PP1a) depends on a -1 ribosomal frameshifting event. The proteins, based on similarity to other coronaviruses, include the papain-like proteinase protein (NSP3), 3C-like proteinase (NSP5), RNA-dependent RNA polymerase (NSP12, RdRp), helicase (NSP13, HEL), endoRNAse (NSP15), 2-O-Ribose-Methyltransferase (NSP16) and other nonstructural proteins. SARS-CoV-2 nonstructural proteins are responsible for viral transcription, replication, proteolytic processing, suppression of host immune responses and suppression of host gene expression. The RNA-dependent RNA polymerase is a target of antiviral therapies.
Clonality: Polyclonal
Molecular Weight: 794 kDa
NCBI: 43740578
UniProt: P0DTD1
Purity: Affinity purification
Sequence: RRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ
Target: NSP4
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: SARS-CoV-2
Western blot analysis of lysates from wild type (WT) and293T cells transfected withSARS-CoV-2 NSP4 usingSARS-CoV-2 NSP4 Rabbit pAb (A20281) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 20µg/10 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:180s.