SARS-CoV-2 Spike ECD Rabbit pAb

Catalog Number: ABB-A20497
Article Name: SARS-CoV-2 Spike ECD Rabbit pAb
Biozol Catalog Number: ABB-A20497
Supplier Catalog Number: A20497
Alternative Catalog Number: ABB-A20497-100UL,ABB-A20497-20UL,ABB-A20497-500UL,ABB-A20497-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike ECD
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Clonality: Polyclonal
Molecular Weight: 141kDa
NCBI: 43740568
UniProt: P0DTC2
Purity: Affinity purification
Sequence: VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY
Target: Spike ECD
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: SARS-CoV-2
Western blot analysis of lysates from 293T cells, using SARS-CoV-2 Spike ECD Rabbit pAb (A20497) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of lysates from 293T cells, using SARS-CoV-2 Spike ECD Rabbit pAb (A20497) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.