DREB1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21961
Article Name: DREB1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21961
Supplier Catalog Number: A21961
Alternative Catalog Number: ABB-A21961-50UL,ABB-A21961-200UL,ABB-A21961-1000UL,ABB-A21961-500UL,ABB-A21961-20UL,ABB-A21961-100UL,ABB-A21961-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: A. thaliana
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of arabidopsis thaliana DREB1B (NP_567721.1).
Conjugation: Unconjugated
Alternative Names: ATCBF1, C-repeat/DRE binding factor 1, DRE BINDING PROTEIN 1B, DREB1B, T30C3.11, TRANSCRIPTIONAL ACTIVATOR CBF1
Transcriptional activator that binds to the DRE/CRT regulatory element and induces COR (cold-regulated) gene expression increasing plant freezing tolerance. It encodes a member of the DREB subfamily A-1 of ERF/AP2 transcription factor family (CBF1). The
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 828653
UniProt: P93835
Source: Rabbit
Purity: Affinity purification
Sequence: GVRQRNSGKWVSEVREPNKKTRIWLGTFQTAEMAARAHDVAALALRGRSACLNFADSAWRLRIPESTCAKDIQKAAAEAALAFQDETCDTTTTNHGLDMEE
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-reactivity: Arabidopsis thaliana