TGF beta induced (TGFBI) Rabbit mAb, Clone: [ARC52500], Unconjugated, Monoclonal

Product Overview

• Article Name: TGF beta induced (TGFBI) Rabbit mAb, Clone: [ARC52500], Unconjugated, Monoclonal
• Biozol Catalog Number: ABB-A21964
• Supplier Catalog Number: A21964
• Alternative Catalog Number: ABB-A21964-1000UL,ABB-A21964-200UL,ABB-A21964-20UL,ABB-A21964-100UL,ABB-A21964-50UL,ABB-A21964-500UL,ABB-A21964-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TGF beta induced (TGFBI) (NP_000349.1).
• Conjugation: Unconjugated
• Alternative Names: CSD, CDB1, CDG2, CSD1, CSD2, CSD3, EBMD, LCD1, BIGH3, CDGG1, TGF beta induced (TGFBI)

Product Description

This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein p

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC52500]
• Molecular Weight: 75kDa
• NCBI: 7045
• UniProt: Q15582
• Source: Rabbit
• Purity: Affinity purification
• Sequence: LPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA
• Target: TGFBI
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone,Growth factors,Neuroscience