Calretinin Rabbit mAb, Clone: [ARC53565], Unconjugated, Monoclonal

Catalog Number: ABB-A21965
Article Name: Calretinin Rabbit mAb, Clone: [ARC53565], Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A21965
Supplier Catalog Number: A21965
Alternative Catalog Number: ABB-A21965-50UL,ABB-A21965-20UL,ABB-A21965-100UL,ABB-A21965-500UL,ABB-A21965-200UL,ABB-A21965-1000UL,ABB-A21965-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-271 of human Calretinin (NP_001731.2).
Conjugation: Unconjugated
Alternative Names: CR, CAL2, CAB29, Calretinin
This gene encodes an intracellular calcium-binding protein belonging to the troponin C superfamily. Members of this protein family have six EF-hand domains which bind calcium. This protein plays a role in diverse cellular functions, including message tar
Clonality: Monoclonal
Clone Designation: [ARC53565]
Molecular Weight: 32kDa
NCBI: 794
UniProt: P22676
Source: Rabbit
Purity: Affinity purification
Sequence: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAG
Target: CALB2
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:10000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Neuroscience,Calcium Signaling