Sin3A Rabbit mAb, Clone: [ARC54250], Unconjugated, Monoclonal

Catalog Number: ABB-A21966
Article Name: Sin3A Rabbit mAb, Clone: [ARC54250], Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A21966
Supplier Catalog Number: A21966
Alternative Catalog Number: ABB-A21966-50UL,ABB-A21966-500UL,ABB-A21966-20UL,ABB-A21966-1000UL,ABB-A21966-100UL,ABB-A21966-200UL,ABB-A21966-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Sin3A (NP_056292.1).
Conjugation: Unconjugated
Alternative Names: WITKOS, DEL15Q24, CHR15DELq24, Sin3A
The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.
Clonality: Monoclonal
Clone Designation: [ARC54250]
Molecular Weight: 145kDa
NCBI: 25942
UniProt: Q96ST3
Source: Rabbit
Purity: Affinity purification
Sequence: MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQ
Target: SIN3A
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Cancer,Endocrine Metabolism,Lipid Metabolism,Neuroscience,Neurodegenerative Diseases