Coagulation factor III/Tissue Factor Rabbit mAb, Unconjugated

Catalog Number: ABB-A23243
Article Name: Coagulation factor III/Tissue Factor Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A23243
Supplier Catalog Number: A23243
Alternative Catalog Number: ABB-A23243-100UL,ABB-A23243-20UL,ABB-A23243-1000UL,ABB-A23243-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TF, TFA, CD142, Coagulation factor III/Tissue Factor
This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces, for example, on monocytes. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. Platelets and monocytes have been shown to express this coagulation factor under procoagulatory and proinflammatory stimuli, and a major role in HIV-associated coagulopathy has been described. Platelet-dependent monocyte expression of coagulation factor III has been described to be associated with Coronavirus Disease 2019 (COVID-19) severity and mortality. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.
Clonality: Monoclonal
Clone Designation: [ARC60559]
Molecular Weight: 33kDa
NCBI: 2152
UniProt: P13726
Purity: Affinity purification
Sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Target: F3
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human, ResearchArea: Immunology Inflammation,CDs,Cardiovascular,Blood.
Immunohistochemistry analysis of paraffin-embedded Human brain tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human cervix tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at 1:1000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): HEL
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of A-431 and MCF7(Negative sample) cells using Coagulation factor III/Tissue Factor Rabbit mAb (A23243) at dilution of 1:300 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.