DiMethyl-Histone H3-K9 Rabbit pAb, Unconjugated

Product Overview

• Article Name: DiMethyl-Histone H3-K9 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A2359
• Supplier Catalog Number: A2359
• Alternative Catalog Number: ABB-A2359-20UL,ABB-A2359-100UL,ABB-A2359-500UL,ABB-A2359-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, DOT, ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: H3t, H3.4, H3/g, H3FT, H3C16, HIST3H3, DiMethyl-Histone H3-K9

Product Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 15 kDa
• NCBI: 8290
• UniProt: Q16695
• Purity: Affinity purification
• Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
• Target: H3-4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|DB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.|ChIP,5µg antibody for 5µg-10µg of Chromatin|ChIP-s
• Application Notes: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted), ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway.

Images

Dot-blot analysis of all sorts of methylation peptides using DiMethyl-Histone H3-K9 antibody (A2359).

Immunohistochemistry analysis of paraffin-embedded Human kidney using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of lysates from HeLa cells, using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded Mouse kidney using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:20 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunofluorescence analysis of A-549 cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using DiMethyl-Histone H3-K9 Rabbit pAb (A2359) at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using DiMethyl-Histone H3-K9 antibody (A2359) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.