ALPK1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ALPK1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24028
• Supplier Catalog Number: A24028
• Alternative Catalog Number: ABB-A24028-100UL,ABB-A24028-1000UL,ABB-A24028-500UL,ABB-A24028-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: LAK, ROSAH, 8430410J10Rik, ALPK1

Product Description

Alpha-protein kinase 1, also known as alpha-kinase 1 (ALPK1), is associated with chronic kidney disease (CKD), myocardial infarction, gout and type 2 diabetes mellitus (DM). ALPK1 mutant has been reported to cause severe defects in motor co-ordination in mice. ALPK1 enhances the expression of proinflammatory cytokines including IL-1beta, IL-8 and TGF-beta1 in cultured human THP1 and human embryonic kidney 293 (HEK293) cells . ALPK1 short isoform (108 kDa) was highly expressed in brain, spinal cord, heart, lung, spleen, thymus, small intestine, skin and testis, while detectable inskeletal muscle and kidney. ALPK1 large isoform (130 kDa) appeared in heart, lung, thymus and skin.

Product Properties

• Clonality: Polyclonal
• Concentration: WB
• Molecular Weight: 139kDa
• NCBI: 80216
• UniProt: Q96QP1
• Purity: Affinity purification
• Sequence: MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYE
• Target: ALPK1

Application Notes

• Application Dilute: WB,1:500 - 1:1000
• Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Protein Trafficking,Vesicle Transport,Regulation. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293T cells transfected withALPK1 usingALPK1 Rabbit pAb (A24028) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:10s.
<,b>,WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS<,/b>,