NSUN2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A24132
Article Name: NSUN2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A24132
Supplier Catalog Number: A24132
Alternative Catalog Number: ABB-A24132-500UL,ABB-A24132-100UL,ABB-A24132-20UL,ABB-A24132-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MISU, MRT5, SAKI, TRM4, NSUN2
This gene encodes a methyltransferase that catalyzes the methylation of cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors. This modification is necessary to stabilize the anticodon-codon pairing and correctly translate the mRNA. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Clonality: Monoclonal
Clone Designation: [ARC65426]
Molecular Weight: 86 kDa
NCBI: 54888
UniProt: Q08J23
Purity: Affinity purification
Sequence: SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG
Target: NSUN2
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:2000|IF/ICC,1:200 - 1:800|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding.
Western blot analysis of lysates from 293F cells using NSUN2 Rabbit mAb (A24132) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1 s.
Immunohistochemistry analysis of paraffin-embeddedMouse spleen tissue usingNSUN2 Rabbit mAb(A24132) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from Mouse liver usingNSUN2 Rabbit mAb (A24132) at1:1000 dilution dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:45 s.
Immunohistochemistry analysis of paraffin-embeddedMouse intestin tissue usingNSUN2 Rabbit mAb(A24132) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman thyroid cancer tissue usingNSUN2 Rabbit mAb(A24132) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman colon tissue usingNSUN2 Rabbit mAb(A24132) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of U-251 MG cells usingNSUN2 Rabbit mAb (A24132,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of U-2 OS cells usingNSUN2 Rabbit mAb (A24132,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunoprecipitation of NSUN2 in 300 µg extracts from 293T cells using 3 µg NSUN2 Rabbit mAb (A24132). Western blot analysis was performed using NSUN2 Rabbit mAb (A24132) at 1:1000 dilution.