PGHS-2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24438
Article Name: PGHS-2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24438
Supplier Catalog Number: A24438
Alternative Catalog Number: ABB-A24438-20UL,ABB-A24438-100UL,ABB-A24438-500UL,ABB-A24438-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: COX2, COX-2, PHS-2, PGG/HS, PGHS-2, hCox-2, GRIPGHS
Prostaglandin-endoperoxide synthase (PTGS), also known as cyclooxygenase, is the key enzyme in prostaglandin biosynthesis, and acts both as a dioxygenase and as a peroxidase. There are two isozymes of PTGS: a constitutive PTGS1 and an inducible PTGS2, which differ in their regulation of expression and tissue distribution. This gene encodes the inducible isozyme. It is regulated by specific stimulatory events, suggesting that it is responsible for the prostanoid biosynthesis involved in inflammation and mitogenesis.
Clonality: Polyclonal
Concentration: WB
Molecular Weight: 69kDa
NCBI: 5743
UniProt: P35354
Purity: Affinity purification
Sequence: GETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKERSTEL
Target: PTGS2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Blood,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates, using PGHS-2 Rabbit pAb (A24438) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.