LHX6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24461
Article Name: LHX6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24461
Supplier Catalog Number: A24461
Alternative Catalog Number: ABB-A24461-100UL,ABB-A24461-20UL,ABB-A24461-1000UL,ABB-A24461-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LHX6, LHX6.1, LIM homeobox 6
This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein has tandem LIM domains as well as a DNA-binding homeodomain. The protein functions as a transcription factor involved in embryogenesis and head development and is highly expressed in neural crest derived mesenchyme cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Clonality: Polyclonal
Molecular Weight: 19kDa/38kDa/40kDa/41kDa/43kDa
NCBI: 26468
UniProt: Q9UPM6
Purity: Affinity purification
Sequence: QKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDDIHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGP
Target: LHX6
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Cell Biology & Developmental Biology,Cell Cycle,Cell differentiation,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using LHX6 Rabbit pAb (A24461) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):MOLT-4
Exposure time: 30s.