p19ARF Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: p19ARF Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24462
• Supplier Catalog Number: A24462
• Alternative Catalog Number: ABB-A24462-20UL,ABB-A24462-100UL,ABB-A24462-500UL,ABB-A24462-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Arf, MTS1, Pctr1, p19ARF, p19, ARF-INK4a, INK4a-ARF, Ink4a/Arf,

Product Description

Enables MDM2/MDM4 family protein binding activity, enzyme inhibitor activity, and protein N-terminus binding activity. Involved in several processes, including negative regulation of lymphocyte proliferation, positive regulation of apoptotic process, and regulation of transcription, DNA-templated. Acts upstream of or within several processes, including negative regulation of cellular protein metabolic process, negative regulation of mammary gland epithelial cell proliferation, and positive regulation of apoptotic process involved in mammary gland involution. Located in cytoplasm and granular component. Part of protein-containing complex. Is expressed in several structures, including bone marrow, central nervous system, dorsal root ganglion, eye, and testis. Human ortholog(s) of this gene implicated in several diseases, including breast cancer (multiple), carcinoma (multiple), hematologic cancer (multiple), melanoma (multiple), and nervous system cancer (multiple). Orthologous to human CDKN2A (cyclin dependent kinase inhibitor 2A).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 19 kDa
• NCBI: 12578
• UniProt: Q64364
• Purity: Affinity purification
• Sequence: MGRRFLVTVRIQRAGRPLQERVFLVKFVRSRRPRTASCALAFVNMLLRLERILRRGPHRNPGPGDDDGQRSRSSSSAQLRCRFELRGPHYLLPPGARRSA
• Target: CDKN2A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. Shipping: Ice Bag

Images

Western blot analysis of lysates from 293F cells, using p19ARF Rabbit pAb (A24462) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.