XPO6 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: XPO6 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24463
• Supplier Catalog Number: A24463
• Alternative Catalog Number: ABB-A24463-20UL,ABB-A24463-100UL,ABB-A24463-500UL,ABB-A24463-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: XPO6, EXP6, RANBP20, exportin-6

Product Description

The protein encoded by this gene is a member of the importin-beta family. Members of this family are regulated by the GTPase Ran to mediate transport of cargo across the nuclear envelope. This protein has been shown to mediate nuclear export of profilin-actin complexes. A pseudogene of this gene is located on the long arm of chromosome 14. Alternative splicing results in multiple transcript variants that encode different protein isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 127kDa/128kDa
• NCBI: 23214
• UniProt: Q96QU8
• Purity: Affinity purification
• Sequence: DIGRQDWPMFYHDFFTNILQLIQSPVTTPLGLIMLKTTSEELACPREDLSVARKEELRKLLLDQVQTVLGLLTGILETVWDKHSVTAATPPPSPTSGESGD
• Target: XPO6
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using XPO6 Rabbit pAb (A24463) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.