NDUFS7 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NDUFS7 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24466
• Supplier Catalog Number: A24466
• Alternative Catalog Number: ABB-A24466-20UL,ABB-A24466-100UL,ABB-A24466-500UL,ABB-A24466-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NDUFS7, CI-20, CI-20KD, MY017, PSST, NADH:ubiquinone oxidoreductase core subunit S7

Product Description

This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 22kDa/23kDa
• NCBI: 374291
• UniProt: O75251
• Purity: Affinity purification
• Sequence: WPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYY
• Target: NDUFS7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Endocrine & Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using NDUFS7 Rabbit pAb (A24466) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.