ZDHHC15 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ZDHHC15 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24473
• Supplier Catalog Number: A24473
• Alternative Catalog Number: ABB-A24473-100UL,ABB-A24473-20UL,ABB-A24473-500UL,ABB-A24473-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ZDHHC15, DHHC15, MRX91, palmitoyltransferase ZDHHC15

Product Description

The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 17kDa/38kDa/39kDa
• NCBI: 158866
• UniProt: Q96MV8
• Purity: Affinity purification
• Sequence: FGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET
• Target: ZDHHC15
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ZDHHC15 Rabbit pAb, using ZDHHC15 Rabbit pAb (A24473) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.