PARVA Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PARVA Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24474
• Supplier Catalog Number: A24474
• Alternative Catalog Number: ABB-A24474-100UL,ABB-A24474-20UL,ABB-A24474-500UL,ABB-A24474-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PARVA, CH-ILKBP, MXRA2, alpha-parvin

Product Description

This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 20kDa/42kDa
• NCBI: 55742
• UniProt: Q9NVD7
• Purity: Affinity purification
• Sequence: MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKV
• Target: PARVA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Cytoskeleton,Microfilaments,Extracellular Matrix. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using PARVA Rabbit pAb (A24474) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.