NAPSA Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: NAPSA Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24485
• Supplier Catalog Number: A24485
• Alternative Catalog Number: ABB-A24485-100UL,ABB-A24485-20UL,ABB-A24485-1000UL,ABB-A24485-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: NAPSA, KAP, Kdap, NAP1, NAPA, SNAPA, napsin-A

Product Description

This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 45kDa
• NCBI: 9476
• UniProt: O96009
• Purity: Affinity purification
• Sequence: KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLG
• Target: NAPSA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Cell Biology & Developmental Biology,Ubiquitin. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat lung, using NAPSA Rabbit pAb (A24485) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.