MAdCAM-1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MAdCAM-1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24489
• Supplier Catalog Number: A24489
• Alternative Catalog Number: ABB-A24489-20UL,ABB-A24489-100UL,ABB-A24489-1000UL,ABB-A24489-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MAdCAM-1

Product Description

Predicted to enable integrin binding activity involved in cell-matrix adhesion. Acts upstream of or within keratinocyte differentiation and leukocyte migration. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in eyelid, hair follicle, and hemolymphoid system. Orthologous to human MADCAM1 (mucosal vascular addressin cell adhesion molecule 1).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• NCBI: 17123
• UniProt: Q61826
• Purity: Affinity purification
• Sequence: QSFQVNPPESEVAVAMGTSLQITCSMSCDEGVARVHWRGLDTSLGSVQTLPGSSILSVRGMLSDTGTPVCVGSCGSRSFQHSVKILVY
• Target: Madcam1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse small intestine, using MAdCAM-1 Rabbit pAb (A24489) at 1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.