IL15 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: IL15 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24510
• Supplier Catalog Number: A24510
• Alternative Catalog Number: ABB-A24510-100UL,ABB-A24510-20UL,ABB-A24510-500UL,ABB-A24510-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IL15, IL-15, interleukin-15

Product Description

The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each others activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Alternatively spliced transcript variants of this gene have been reported.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 14kDa/18kDa
• NCBI: 3600
• UniProt: P40933
• Purity: Affinity purification
• Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Target: IL15
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Tumor immunology,Endocrine & Metabolism,Endocrine and metabolic diseases,Obesity,Immunology & Inflammation,Cytokines,Interleukins,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse heart, using IL15 Rabbit pAb (A24510) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.