TNF RII/TNFRSF1B/CD120b Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TNF RII/TNFRSF1B/CD120b Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24513
• Supplier Catalog Number: A24513
• Alternative Catalog Number: ABB-A24513-20UL,ABB-A24513-100UL,ABB-A24513-1000UL,ABB-A24513-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p75, TNFBR, Tnfr2, CD120b, TNF-R2, TNFR80, TNFRII, Tnfr-1, TNF-R75, TNF-R-II, TNF-alphaR2, TNFalpha-R2, TNF RII/TNFRSF1B/CD120b

Product Description

Enables tumor necrosis factor-activated receptor activity. Involved in several processes, including negative regulation of extracellular matrix constituent secretion, regulation of nervous system development, and semi-lunar valve development. Acts upstream of or within several processes, including RNA destabilization, apoptotic signaling pathway, and negative regulation of inflammatory response. Located in membrane raft. Is expressed in several structures, including blood, dorsal aorta, extraembryonic component, genitourinary system, and liver. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism, acne, bone disease (multiple), glomerulonephritis (multiple), and lung disease (multiple). Orthologous to human TNFRSF1B (TNF receptor superfamily member 1B).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 50kDa
• NCBI: 21938
• UniProt: P25119
• Purity: Affinity purification
• Sequence: VPAQVVLTPYKPEPGYECQISQEYYDRKAQMCCAKCPPGQYVKHFCNKTSDTVCADCEASMYTQVWNQFRTCLSCSSSCTTDQVEIRACTKQQNRVCACEAGRYCALKTHSGSCRQCMRLSKCGPGFGVASSRAPNGNVLCKACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCAPESPTLSAIPRTLYVSQPEPTRSQPLDQEPGPSQTPSILTSLGSTPIIEQSTKGG
• Target: Tnfrsf1b
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology,Apoptosis, Receptors, Receptor Processing. Shipping: Ice Bag

Images

Western blot analysis of lysates from L929 cells usingTNF RII/TNFRSF1B/CD120b Rabbit pAb (A24513) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.