PPBP Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PPBP Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24514
• Supplier Catalog Number: A24514
• Alternative Catalog Number: ABB-A24514-20UL,ABB-A24514-100UL,ABB-A24514-500UL,ABB-A24514-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1, platelet basic protein

Product Description

The protein encoded by this gene is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. It has been shown to stimulate various cellular processes including DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 13kDa
• NCBI: 5473
• UniProt: P02775
• Purity: Affinity purification
• Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
• Target: PPBP
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Growth factor,Immunology & Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway,Chemokines,Chemokine,Cardiovascular,Blood. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and 293T cells transfected with PPBP, using PPBP Rabbit pAb (A24514) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.