CD134 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD134 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24523
• Supplier Catalog Number: A24523
• Alternative Catalog Number: ABB-A24523-100UL,ABB-A24523-20UL,ABB-A24523-1000UL,ABB-A24523-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Ox40, ACT35, CD134, Ly-70, Txgp1, TXGP1L

Product Description

Enables tumor necrosis factor-activated receptor activity. Involved in negative regulation of apoptotic process, positive regulation of B cell proliferation, and regulation of gene expression. Acts upstream of or within several processes, including cellular defense response, negative regulation of cytokine production, and regulation of protein kinase activity. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 16. Orthologous to human TNFRSF4 (TNF receptor superfamily member 4).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 30kDa
• NCBI: 22163
• UniProt: P47741
• Purity: Affinity purification
• Sequence: VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
• Target: Tnfrsf4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat spleen, using CD134 Rabbit pAb (A24523) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.