TOMM40L Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TOMM40L Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24771
• Supplier Catalog Number: A24771
• Alternative Catalog Number: ABB-A24771-20UL,ABB-A24771-100UL,ABB-A24771-1000UL,ABB-A24771-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: TOMM40B, TOMM40L

Product Description

Predicted to enable protein transmembrane transporter activity. Predicted to be involved in protein import into mitochondrial matrix. Part of protein-containing complex.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 84134
• UniProt: Q969M1
• Purity: Affinity purification
• Sequence: MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGD
• Target: TOMM40L
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics and nuclear signaling, DNA/RNA translation, Signal transduction, metabolism, mitochondria. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse liver usingTOMM40L Rabbit pAb (A24771) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.