MRPL3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MRPL3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24776
• Supplier Catalog Number: A24776
• Alternative Catalog Number: ABB-A24776-20UL,ABB-A24776-100UL,ABB-A24776-1000UL,ABB-A24776-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MRPL3, COXPD9, MRL3, RPML3, mitochondrial ribosomal protein L3

Product Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L3P ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 13q.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 11222
• UniProt: P09001
• Purity: Affinity purification
• Sequence: GRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPSITFA
• Target: MRPL3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,RNA Binding. Shipping: Ice Bag

Images

Western blot analysis of lysates from A-431 cells usingMRPL3 Rabbit pAb (A24776) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.