SOST Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SOST Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24852
• Supplier Catalog Number: A24852
• Alternative Catalog Number: ABB-A24852-20UL,ABB-A24852-100UL,ABB-A24852-1000UL,ABB-A24852-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SOST, CDD, DAND6, SOST1, VBCH, sclerostin

Product Description

Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 50964
• UniProt: Q9BQB4
• Purity: Affinity purification
• Sequence: QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
• Target: SOST
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Stem Cells. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293T cells transfected withSOST usingSOST Rabbit pAb (A24852) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:20s.