CBX7 Rabbit pAb, Polyclonal

Product Overview

• Article Name: CBX7 Rabbit pAb, Polyclonal
• Biozol Catalog Number: ABB-A25023
• Supplier Catalog Number: A25023
• Alternative Catalog Number: ABB-A25023-20UL,ABB-A25023-100UL,ABB-A25023-1000UL,ABB-A25023-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Alternative Names: CBX7

Product Description

This gene encodes a protein that contains the CHROMO (CHRomatin Organization MOdifier) domain. The encoded protein is a component of the Polycomb repressive complex 1 (PRC1), and is thought to control the lifespan of several normal human cells.

Product Properties

• Clonality: Polyclonal
• Concentration: WB
• Molecular Weight: 28kDa
• NCBI: 23492
• UniProt: O95931
• Purity: Affinity purification
• Sequence: NLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF
• Target: CBX7
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag

Images

Western blot analysis of various lysates using CBX7 Rabbit pAb (A25023) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.