C/EBPalpha Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: C/EBPalpha Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25033
• Supplier Catalog Number: A25033
• Alternative Catalog Number: ABB-A25033-20UL,ABB-A25033-100UL,ABB-A25033-500UL,ABB-A25033-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CEBP, C/EBP-alpha, C/EBPalpha

Product Description

This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain and recognizes the CCAAT motif in the promoters of target genes. The encoded protein functions in homodimers and also heterodimers with CCAAT/enhancer-binding proteins beta and gamma. Activity of this protein can modulate the expression of genes involved in cell cycle regulation as well as in body weight homeostasis. Mutation of this gene is associated with acute myeloid leukemia. The use of alternative in-frame non-AUG (GUG) and AUG start codons results in protein isoforms with different lengths. Differential translation initiation is mediated by an out-of-frame, upstream open reading frame which is located between the GUG and the first AUG start codons.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 38kDa
• NCBI: 1050
• UniProt: P49715
• Purity: Affinity purification
• Sequence: VGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPG
• Target: CEBPA
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Signal Transduction,Endocrine Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse liver usingC/EBPalpha Rabbit pAb (A25033) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.