ACAA1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ACAA1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25034
• Supplier Catalog Number: A25034
• Alternative Catalog Number: ABB-A25034-100UL,ABB-A25034-20UL,ABB-A25034-1000UL,ABB-A25034-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: ACAA, THIO, PTHIO, Lnc-Myd88, ACAA1

Product Description

This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 44kDa
• NCBI: 30
• UniProt: P09110
• Purity: Affinity purification
• Sequence: AARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVV
• Target: ACAA1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Lipid Metabolism,Cardiovascular,Lipids,Fatty Acids. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse liver usingACAA1 Rabbit pAb (A25034) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.