Il15ra Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Il15ra Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25036
• Supplier Catalog Number: A25036
• Alternative Catalog Number: ABB-A25036-100UL,ABB-A25036-20UL,ABB-A25036-500UL,ABB-A25036-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IL-15RA, Il15ra

Product Description

Predicted to enable interleukin-15 receptor activity and protein kinase binding activity. Acts upstream of or within positive regulation of natural killer cell differentiation. Located in cytoplasmic vesicle and plasma membrane. Is expressed in central nervous system, retina, retina inner nuclear layer, and retina outer nuclear layer. Orthologous to human IL15RA (interleukin 15 receptor subunit alpha).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 28kDa
• NCBI: 16169
• UniProt: Q60819
• Purity: Affinity purification
• Sequence: GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFKRKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSLAHY
• Target: Il15ra
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cell Biology, Apoptosis, Receptors, Associated Proteins. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse liver usingIl15ra Rabbit pAb (A25036) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.