CD26/DPP4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD26/DPP4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25039
• Supplier Catalog Number: A25039
• Alternative Catalog Number: ABB-A25039-100UL,ABB-A25039-20UL,ABB-A25039-1000UL,ABB-A25039-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD26, ADABP, ADCP2, DPPIV, TP103, CD26/DPP4

Product Description

The DPP4 gene encodes dipeptidyl peptidase 4, which is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic type II transmembrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Dipeptidyl peptidase 4 is highly involved in glucose and insulin metabolism, as well as in immune regulation. This protein was shown to be a functional receptor for Middle East respiratory syndrome coronavirus (MERS-CoV), and protein modeling suggests that it may play a similar role with SARS-CoV-2, the virus responsible for COVID-19.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 88kDa
• NCBI: 1803
• UniProt: P27487
• Purity: Affinity purification
• Sequence: NKGTDDATADSRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNAT
• Target: DPP4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Ubiquitin,Endocrine Metabolism,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of lysates from Rat kidney usingCD26/DPP4 Rabbit pAb (A25039) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.