RPE65 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: RPE65 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25105
• Supplier Catalog Number: A25105
• Alternative Catalog Number: ABB-A25105-20UL,ABB-A25105-100UL,ABB-A25105-500UL,ABB-A25105-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: p63, BCO3, LCA2, RP20, rd12, mRPE65, sRPE65, RPE65

Product Description

The protein encoded by this gene is a component of the vitamin A visual cycle of the retina which supplies the 11-cis retinal chromophore of the photoreceptors opsin visual pigments. It is a member of the carotenoid cleavage oxygenase superfamily. All members of this superfamily are non-heme iron oxygenases with a seven-bladed propeller fold and oxidatively cleave carotenoid carbon:carbon double bonds. However, the protein encoded by this gene has acquired a divergent function that involves the concerted O-alkyl ester cleavage of its all-trans retinyl ester substrate and all-trans to 11-cis double bond isomerization of the retinyl moiety. As such, it performs the essential enzymatic isomerization step in the synthesis of 11-cis retinal. Mutations in this gene are associated with early-onset severe blinding disorders such as Leber congenital.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 61kDa
• NCBI: 6121
• UniProt: Q16518
• Purity: Affinity purification
• Sequence: YLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLN
• Target: RPE65
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience, Cell Type Marker. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse eye usingRPE65 Rabbit pAb (A25105) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.